General Information

  • ID:  hor001855
  • Uniprot ID:  P81264
  • Protein name:  Prolactin-releasing peptide PrRP31
  • Gene name:  PRLH
  • Organism:  Bos taurus (Bovine)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  Medulla oblongata and hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031861 prolactin-releasing peptide receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0043434 response to peptide hormone
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF
  • Length:  31
  • Propeptide:  MKAVGAWLLCLLLLGLALQGAASRAHQHSMEIRTPDINPAWYAGRGIRPVGRFGRRRAAPGDGPRPGPRRVPACFRLEGGAEPSRALPGRLTAQLVQE
  • Signal peptide:  MKAVGAWLLCLLLLGLALQGAA
  • Modification:  T31 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates prolactin (PRL) release and regulates the expression of prolactin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PRLHR
  • Target Unid:  Q4EW11
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BZL1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9BZL1-F1.pdbhor001855_AF2.pdbhor001855_ESM.pdb

Physical Information

Mass: 411232 Formula: C157H243N53O42S
Absent amino acids: CKL Common amino acids: R
pI: 11.91 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -82.58 Boman Index: -8643
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 56.77
Instability Index: 3406.45 Extinction Coefficient cystines: 6990
Absorbance 280nm: 233

Literature

  • PubMed ID:  NA
  • Title:  NA